Gblocks 0.91b Results

Processed file: nad3.pir
Number of sequences: 17
Alignment assumed to be: Protein
New number of positions: 56 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
nad3_parde       ------MEYLLQEYLPILVFLGMASALAIVLILAAAVIAVRN--PDPEKVSAYECGFNAF
nad3_acaca       ---------MTLEYIYIFIFFWGAFFISCLLIFLSYFLVYQE--SDIEKNSAYECGFQPF
nad3_allma       --------------MTYLVYIVFTIVLTVGLILVSYLLSQAQ--PDSEKVSAYECGFSPL
nad3_apec        -----------IFNFLTLFVSILIFLITTLITFAAHFLPSRN-TD-SEKSSPYECGFDPL
nad3_arath       ---------MMSEFAPISIYLVISLLVSLILLGVPFPFASNS-STYPEKLSAYECGFDPS
nad3_balca       -------------MNSFLIYLLIAITLSFILSIVGHRLPTRN-MD-QEKLSPYECGFDPQ
nad3_chocr       ------MKLIFTEYSAILIFFAISSLLSSVIFLLSYFLIPQK--PDQEKVSAYECGFNPF
nad3_drome       -------------MFSIIFIALLILLITTIVMFLASILSKKA-LIDREKSSPFECGFDPK
nad3_human       -------------MN-FALILMINTLLALLLMIITFWLPQLN-GY-MEKSTPYECGFDPM
nad3_ktun        -------------MFFVLSLVLFTFLLSLVLLSVSLSLTKKK-MMNREKSSPFECGFDPK
nad3_lter        -------------MILTALSSAIALLVPIIILGAAWVLASRS-TEDREKSSPFECGFDPK
nad3_marpo       -----------MEFAPIFVYLVISLLLSLILIGVSFLFASSSSLAYPEKLSAYECGFDPF
nad3_metse       ---------MYTEFYGILVLLIFSVVLSAIISGASYILGDKQ--PDREKVSAYECGFDPF
nad3_picca       MLNYFVYPYGIENDMGMKFYMMLVPMMSMVLMMINYMMTNKS-DNNMNKTGPYECGFDSF
nad3_podan       -------------MSSMTLFILFVSIIALLFLFINLIFAPHN--PYQEKYSIFECGFHSF
nad3_prowi       ----------MYEFLGILIYFFIALALSLLLLGLPFLVSTRK--ADPEKISAYECGFDPF
nad3_recam       -----MNTMILSEYLSVLIFFIFSFGLSCIILGLSYVLATQN--ADTEKLSPYECGFNPF
                                                                #############


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
nad3_parde       D-DARMKFDVRFYLVSILFIIFDLEVAFLFPWAVSFASLS-DVAFWGLMVFLAVLTVGFA
nad3_acaca       E-DTRSKFNVRYYLIAILFMIFDLEIMYLFPWSISISTGS-FFGVWAIFLFLIILTVGFI
nad3_allma       G-DARQKFDVSFYLIAILFIIFDLEVVFILPFASVIHNVS-LLGGWITIIFLVILTIGFI
nad3_apec        N-SARVPFSFRFFLVAILFLLFDLEIALLFPLPFSVFFH--P--IHTP----LILTVGLI
nad3_arath       G-DARSRFDIRFYLVSILFLIPDLEVTFFFPWAVPPNKID-LFGFWSMMAFLFILTIGFL
nad3_balca       A-SARLPFSLRFFLVAILFLLFDLEIALLLPFPAALSARDPQLSFTLAFLILLILTIGLI
nad3_chocr       D-DARATFDIRFYLVAILFLIFDLEISFLFPWSLVLGEIS-IIGFWSMIVFLVILTIGFI
nad3_drome       S-SSRLPFSLRFFLITIIFLIFDVEIALILPMIIIMKYSNIMIWTITSIIFILILLIGLY
nad3_human       S-PARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLA
nad3_ktun        S-SARLPFSMRFFLITVVFLVFDVEIVLLLPYLFSSGWSIDVFSLVGSMMILVILIIGVL
nad3_lter        S-TARIPFSTRFFLLAIIFIVFDIEIVLLMPLPTILHTSDVFTTVTTSVLFLMILLIGLI
nad3_marpo       D-DARSRFDIRFYLVSILFIIFDLEVTFLFPWAVSLNKIG-LFGFWSMMVFLFILTIGFV
nad3_metse       G-TPGRPFSIRFFLIGILFLIFDLEISFLFPWCVVCNQVF-PFGYWTMIVFLAVLTLGLV
nad3_picca       R-QSRTTYSIKFILIAILFLPFDLELTSILPYTLSMYNTN-IYGLFILLYFLLPLIIGFI
nad3_podan       LGQNRTQFGVKFFIFALVYLLLDLEILLTFPFAVSEYVNN-IYGLIILLGFITIITIGFV
nad3_prowi       D-DARGRFDIQFYLVAILFIIFDLEVAFLFPWALTLNKIG-YFGFWSMMLFLFILTVGFI
nad3_recam       D-DARGAFDVRFYLVAILFIIFDLEVAFLFPWAVALSDVT-IFGFWTMFIFLLILTVGFI
                    ############################                      #######


                        130       140       150
                 =========+=========+=========+===
nad3_parde       YEWKKGALEWA----------------------
nad3_acaca       YEWQKGALEWD----------------------
nad3_allma       YEFVSGAITDSF---------------------
nad3_apec        FEWVQGGLDWAE---------------------
nad3_arath       YEWKRGASDRE----------------------
nad3_balca       YEWMEGGLEWAE---------------------
nad3_chocr       YEWYKGALEWE----------------------
nad3_drome       HEWNQGMLNWSN---------------------
nad3_human       YEWLQKGLDWTE---------------------
nad3_ktun        HEWSEGSLEWFSSSN------------------
nad3_lter        HEWKEGSLDWSS---------------------
nad3_marpo       YEWKKGALDWE----------------------
nad3_metse       YEWLKGGLEWE----------------------
nad3_picca       IEINTKAIYMTKMFNRNVKSMTSYVKYNNKI--
nad3_podan       YELGKSALKIDSRQVITMTRFNYSSTIEYLGKI
nad3_prowi       YEWRKGALDWS----------------------
nad3_recam       YEWKKGALDWE----------------------
                 ########                         






Parameters used Minimum Number Of Sequences For A Conserved Position: 9 Minimum Number Of Sequences For A Flanking Position: 14 Maximum Number Of Contiguous Nonconserved Positions: 8 Minimum Length Of A Block: 10 Allowed Gap Positions: None Use Similarity Matrices: Yes
Flank positions of the 3 selected block(s)
Flanks: [48  60]  [64  91]  [114  128]  

New number of positions in nad3.pir-gb:  56  (36% of the original 153 positions)